Structure of PDB 4ynl Chain M Binding Site BS02

Receptor Information
>4ynl Chain M (length=77) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERTYIMVEDTARYFRMMKDWAEKRPNAMRALEELDVPPERWDEAMQELDE
IIRTWADKYHQVGGIPMILQMVFGRKE
Ligand information
>4ynl Chain R (length=6) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ERGSGR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ynl Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
Resolution2.1 Å
Binding residue
(original residue number in PDB)
W241 R250 A251 L252 E253 E254 D256
Binding residue
(residue number reindexed from 1)
W20 R29 A30 L31 E32 E33 D35
Enzymatic activity
Enzyme Commision number 3.4.21.-
External links
PDB RCSB:4ynl, PDBe:4ynl, PDBj:4ynl
PDBsum4ynl
PubMed26576507
UniProtP27709|HETR_NOSS1 DNA-binding transcriptional activator HetR (Gene Name=hetR)

[Back to BioLiP]