Structure of PDB 4v4j Chain M Binding Site BS02

Receptor Information

>4v4j Chain M (length=106) Species: 262724 (Thermus thermophilus HB27)

YERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLAL
KLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAR
EGGLEF

Ligand information

>4v4j Chain x (length=120)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggga

<<<<<<<<<<.....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>..
.>...>>>..>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v4j Interactions and dynamics of the Shine Dalgarno helix in the 70S ribosome.
• Resolution: 3.83 Å
• Binding residue (original residue number in PDB): R17 F29 S31 H34 Q38 I40 V46 T47 L48 V49 S50 N61 K62 R89 K93 H95 G96 R97
• Binding residue (residue number reindexed from 1): R11 F23 S25 H28 Q32 I34 V40 T41 L42 V43 S44 N55 K56 R83 K87 H89 G90 R91

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4j, PDBe:4v4j, PDBj:4v4j
• PDBsum: 4v4j
• PubMed: 17940016
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)