Structure of PDB 4pjo Chain M Binding Site BS02

Receptor Information
>4pjo Chain M (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLID
KTT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pjo ?
Resolution3.3 Å
Binding residue
(original residue number in PDB)		T11 Y12 T14 H24 G27 R28
Binding residue
(residue number reindexed from 1)		T10 Y11 T13 H23 G26 R27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005685 U1 snRNP

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pjo, PDBe:4pjo, PDBj:4pjo
PDBsum4pjo
PubMed25555158
UniProtP09234|RU1C_HUMAN U1 small nuclear ribonucleoprotein C (Gene Name=SNRPC)

[Back to BioLiP]