Structure of PDB 3zn8 Chain M Binding Site BS02

Receptor Information
>3zn8 Chain M (length=106) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLTLRDVYAQIIALRKMGPLSKVLQHIPGLGIMLPTPSEDQLKIGEEKIR
RWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMN
RLLKMV
Ligand information
>3zn8 Chain S (length=14) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIILVLLIWGTVLL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zn8 Structural Basis of Signal Sequence Surveillance and Selection by the Srp-Sr Complex
Resolution12.0 Å
Binding residue
(original residue number in PDB)		H351 I352 W377 E416 W420 M424
Binding residue
(residue number reindexed from 1)		H26 I27 W52 E91 W95 M99
Enzymatic activity
Enzyme Commision number 3.6.5.4: signal-recognition-particle GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3zn8, PDBe:3zn8, PDBj:3zn8
PDBsum3zn8
PubMed23563142
UniProtQ97ZE7|SRP54_SACS2 Signal recognition particle 54 kDa protein (Gene Name=srp54)

[Back to BioLiP]