--> -->

Structure of PDB 2dys Chain M Binding Site BS02

Receptor Information
>2dys Chain M (length=43) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKS
Traceback (most recent call last):
  File "/var/www/html/BioLiP/pdb.cgi", line 1465, in <module>
    pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
  File "/var/www/html/BioLiP/pdb.cgi", line 903, in display_interaction
    with open('./pdb_cgi_debug.log', 'a') as f:
PermissionError: [Errno 13] Permission denied: './pdb_cgi_debug.log'