Structure of PDB 1u3e Chain M Binding Site BS02

Receptor Information
>1u3e Chain M (length=174) Species: 10685 (Okubovirus SPO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEWKDIKGYEGHYQVSNTGEVYSIKSGKTLKHQIPKDGYHRIGLFKGGKG
KTFQVHRLVAIHFCEGYEEGLVVDHKDGNKDNNLSTNLRWVTQKINVENQ
MSRGTLNVSKAQQIAKIKNQKPIIVISPDGIEKEYPSTKCACEELGLTRG
KVTDVLKGHRIHHKGYTFRYKLNG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u3e DNA Binding and Cleavage by the HNH Homing Endonuclease I-HmuI.
Resolution2.92 Å
Binding residue
(original residue number in PDB)		N96 Q100 T105 N107 V108 A111 I114 A115 N119 T148 G150 K151 R160 H162 K164
Binding residue
(residue number reindexed from 1)		N96 Q100 T105 N107 V108 A111 I114 A115 N119 T148 G150 K151 R160 H162 K164
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1u3e, PDBe:1u3e, PDBj:1u3e
PDBsum1u3e
PubMed15313606
UniProtP34081|HMUI_BPSP1 DNA endonuclease I-HmuI

[Back to BioLiP]