Structure of PDB 1pp8 Chain M Binding Site BS02

Receptor Information
>1pp8 Chain M (length=118) Species: 5722 (Trichomonas vaginalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDSNDLEASFTSRLPPEIVAALKRKSSRDPNSRFPRKLHMLLTYLASNPQ
LEEEIGLSWISDTEFKMKKKNVALVMGIKLNTLNVNLRDLAFEQLQHDKG
GWTQWKRSGFTRNSVFED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pp8 Structural Basis of Core Promoter Recognition in a Primitive Eukaryote
Resolution3.05 Å
Binding residue
(original residue number in PDB)
K25 K69
Binding residue
(residue number reindexed from 1)
K25 K69
Binding affinityPDBbind-CN: Kd=190nM
Enzymatic activity
Enzyme Commision number ?
External links