Structure of PDB 8xt3 Chain Lv Binding Site BS02

Receptor Information
>8xt3 Chain Lv (length=131) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YKTKPTHGIGKYKHLIKAEVRAINLGTDYEYGVLNIHLTAYDMTLAESYA
QYVHNLCNSLSIKVEESYAMPTKTIEVLQLQMLLDSVLTTHERVVQISGL
SATFAEIFLEIIQSSLPEGVRLSVKEHTEED
Ligand information
>8xt3 Chain L2 (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaguguagcuuaaaagcacccaacuuacacuuaggagauucaauugacg
cucuga
<<<<<...<<<....>>>.<<.<<.......>>.>>....<<<..>>>.>
>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8xt3 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		E104 Q108 H111 N112 N115 S124 R155
Binding residue
(residue number reindexed from 1)		E47 Q51 H54 N55 N58 S67 R93
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xt3, PDBe:8xt3, PDBj:8xt3
PDBsum8xt3
PubMed38942792
UniProtQ96GC5|RM48_HUMAN Large ribosomal subunit protein mL48 (Gene Name=MRPL48)

[Back to BioLiP]