Structure of PDB 8xt2 Chain Lv Binding Site BS02

Receptor Information
>8xt2 Chain Lv (length=131) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YKTKPTHGIGKYKHLIKAEVRAINLGTDYEYGVLNIHLTAYDMTLAESYA
QYVHNLCNSLSIKVEESYAMPTKTIEVLQLQMLLDSVLTTHERVVQISGL
SATFAEIFLEIIQSSLPEGVRLSVKEHTEED
Ligand information
>8xt2 Chain L2 (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaguguagcuuaaaagcacccaacuuacacuuaggagauucaauugacg
cucuga
<<<<<...<<<....>>>.<<.<<.......>>.>>....<<<..>>>.>
>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8xt2 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Q108 H111 N112 N115 S124
Binding residue
(residue number reindexed from 1)		Q51 H54 N55 N58 S67
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xt2, PDBe:8xt2, PDBj:8xt2
PDBsum8xt2
PubMed38942792
UniProtQ96GC5|RM48_HUMAN Large ribosomal subunit protein mL48 (Gene Name=MRPL48)

[Back to BioLiP]