Structure of PDB 6zj3 Chain Lp Binding Site BS02

Receptor Information
>6zj3 Chain Lp (length=121) Species: 3039 (Euglena gracilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKVKAHEIRQLEKKDLLKQLDDLKTELAQLRVAKQTSGAASKLCKIKIVR
RSIARVLTVLNMKEKNTLRKLYKNKKYKPLDLRPKKTKKERLALSIIDRR
RKTARQKKILHAYPMRKYYVK
Ligand information
>6zj3 Chain LB (length=133) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugaccuggcgcacauggaaugacccaccgaacuuaagcauaucacucag
uggaggaacagcaagcaaccucgauugcugcaguaauggcgaaugaacga
gcaggacccacggcucuuccugaaaaugggcuu
.......................<<<<<......<......>.......>
>>>.>.........<......>..<<<<<......<<.....>>.....>
>>>>.............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		Y78 R84 K89 K90 L93 R106 Q107 I110 L111 Y114 M116
Binding residue
(residue number reindexed from 1)		Y77 R83 K88 K89 L92 R105 Q106 I109 L110 Y113 M115
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Apr 6 22:37:51 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6zj3', asym_id = 'Lp', bs = 'BS02', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6zj3', asym_id='Lp', bs='BS02', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0000463,0003735,0005840,0006412,0022625', uniprot = '', pdbid = '6zj3', asym_id = 'Lp'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000463,0003735,0005840,0006412,0022625', uniprot='', pdbid='6zj3', asym_id='Lp')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>