Structure of PDB 7zjx Chain Lo Binding Site BS02

Receptor Information
>7zjx Chain Lo (length=50) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL
Ligand information
>7zjx Chain L8 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcu
.........................................<<<<<<<<<
....>>>>.....<.<<<......>>.............>>>..>...>>
>....<<....>><<<<<<<<<.....>>>>>>>>>..............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zjx Structure of the mammalian ribosome as it decodes the selenocysteine UGA codon.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T6 F7 R8 R11 K15 K18 Q19 R21 I23 W26 M29 K30 T31 I35
Binding residue
(residue number reindexed from 1)		T5 F6 R7 R10 K14 K17 Q18 R20 I22 W25 M28 K29 T30 I34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zjx, PDBe:7zjx, PDBj:7zjx
PDBsum7zjx
PubMed35709277
UniProtG1TTN1

[Back to BioLiP]