Structure of PDB 7old Chain Lo Binding Site BS02

Receptor Information
>7old Chain Lo (length=104) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNVPKTRKTFCKGKDCQKHTLHKVTQYKAGKASAFAQGKRRYDRKQSGYG
GQTKPVFHKKAKTTKKIVLRLECSVCKTKKQLPLKRCKHFELGGDKKTKG
AALV
Ligand information
>7old Chain 5 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uccgauauagcguaacggcuaucacaucacgcuuucaccguggagaccgg
gguucgacuccccguaucggagcca
<<<<<<<..<..............>.<<<<<.......>>>>>....<<<
<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7old High-resolution structures of a thermophilic eukaryotic 80S ribosome reveal atomistic details of translocation.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y43 K55 F58
Binding residue
(residue number reindexed from 1)		Y42 K54 F57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7old, PDBe:7old, PDBj:7old
PDBsum7old
PubMed35079002
UniProtG0SBZ6

[Back to BioLiP]