Structure of PDB 8pv4 Chain Ll Binding Site BS02

Receptor Information
>8pv4 Chain Ll (length=50) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSHKTFRIKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGL
Ligand information
>8pv4 Chain C2 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau
.........................................<<<<<<<<<
....>>>>.....<.<<<......>>..............>>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pv4 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		F7 R8 K12 K15 K18 Q19 R21 P24 W26 I27 L29 R30 T31 I35 K40
Binding residue
(residue number reindexed from 1)		F6 R7 K11 K14 K17 Q18 R20 P23 W25 I26 L28 R29 T30 I34 K39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pv4, PDBe:8pv4, PDBj:8pv4
PDBsum8pv4
PubMed37921038
UniProtQ2H9R2

[Back to BioLiP]