Structure of PDB 8oo0 Chain Ll Binding Site BS02

Receptor Information
>8oo0 Chain Ll (length=50) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSHKTFRIKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGL
Ligand information
>8oo0 Chain 4 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		F7 K12 K15 Q19 I23 W26 L29 T31
Binding residue
(residue number reindexed from 1)		F6 K11 K14 Q18 I22 W25 L28 T30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
PDBsum8oo0
PubMed38267453
UniProtQ2H9R2

[Back to BioLiP]