Structure of PDB 6zj3 Chain Lk Binding Site BS02

Receptor Information
>6zj3 Chain Lk (length=131) Species: 3039 (Euglena gracilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKKAVFKRYNKIRTTVQFHRPYTRRTKGQKKYVRRSGRSVSIAQKKDQFH
ILKFPLTTESAMKKIEDNNTLVFIVDIRANKNQIKTAVRKMYDIKAARVN
TLIRPDGLKKAYVKLMPDNDALDIANKIGIL
Ligand information
>6zj3 Chain LB (length=133) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugaccuggcgcacauggaaugacccaccgaacuuaagcauaucacucag
uggaggaacagcaagcaaccucgauugcugcaguaauggcgaaugaacga
gcaggacccacggcucuuccugaaaaugggcuu
.......................<<<<<......<......>.......>
>>>.>.........<......>..<<<<<......<<.....>>.....>
>>>>.............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		Y41 T55 R57 T58 G60 K62 K63 Y64
Binding residue
(residue number reindexed from 1)		Y9 T23 R25 T26 G28 K30 K31 Y32
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 09:02:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6zj3', asym_id = 'Lk', bs = 'BS02', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6zj3', asym_id='Lk', bs='BS02', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zj3', asym_id = 'Lk'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zj3', asym_id='Lk')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>