Structure of PDB 8pv7 Chain Lj Binding Site BS02

Receptor Information

>8pv7 Chain Lj (length=88) Species: 759272 (Thermochaetoides thermophila DSM 1495)

TKGTSSFGKRHNKTHGLCRRCGRRSLHNQKKVCASCGYPAAKTRKYNWSE
KAKRRKVTGTGRMRYLSTVPRRFKNGFRTGVPKGARGP

Ligand information

>8pv7 Chain C2 (length=156)

aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau

.........................................<<<<<<<<<
....>>>>.....<.<<<......>>..............>>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8pv7 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
• Resolution: 2.12 Å
• Binding residue (original residue number in PDB): R20 R21 C22 G23 K32 A42 T59 G60 G62 R63 M64 R65 Y66 L67 R72 F74 K75 N76 R79 T80 G81 V82 P83 A86 R87
• Binding residue (residue number reindexed from 1): R19 R20 C21 G22 K31 A41 T58 G59 G61 R62 M63 R64 Y65 L66 R71 F73 K74 N75 R78 T79 G80 V81 P82 A85 R86

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8pv7, PDBe:8pv7, PDBj:8pv7
• PDBsum: 8pv7
• PubMed: 37921038
• UniProt: G0S101