Structure of PDB 8pv5 Chain Lj Binding Site BS02

Receptor Information
>8pv5 Chain Lj (length=88) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKGTSSFGKRHNKTHGLCRRCGRRSLHNQKKVCASCGYPAAKTRKYNWSE
KAKRRKVTGTGRMRYLSTVPRRFKNGFRTGVPKGARGP
Ligand information
>8pv5 Chain C2 (length=152) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaagugaaucaucgaaucuuuga
acgcacauugcgcccgccgguauuccggcgggcaugccuguucgagcguc
au
.........................................<<<<<<<((
....>>>>.....<.<<<<.....))........>.>>>..>...>>>..
..<<.....>><<<<<<<<<....>>>>>>>>>.................
..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pv5 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
Resolution2.86 Å
Binding residue
(original residue number in PDB)
R20 R21 C22 G23 N29 Y39 T59 G62 R63 M64 R65 Y66 L67 R72 F74 K75 N76 R79 T80 G81 P83 R87
Binding residue
(residue number reindexed from 1)
R19 R20 C21 G22 N28 Y38 T58 G61 R62 M63 R64 Y65 L66 R71 F73 K74 N75 R78 T79 G80 P82 R86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8pv5, PDBe:8pv5, PDBj:8pv5
PDBsum8pv5
PubMed37921038
UniProtG0S101

[Back to BioLiP]