Structure of PDB 7z3o Chain Lj Binding Site BS02

Receptor Information

>7z3o Chain Lj (length=86) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KGTSSFGKRHNKTHGLCRRCGRRSLHNQKKVCASCGYPAAKTRKYNWSEK
AKRRKVTGTGRMRYLSTVPRRFKNGFRTGVPKGARG

Ligand information

>7z3o Chain 4 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau

.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7z3o Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.
Resolution	3.3 Å
Binding residue (original residue number in PDB)	R20 R21 N29 G62 R63 M64 R65 Y66 L67 R72 F74 N76 R79 G81 P83 R87
Binding residue (residue number reindexed from 1)	R18 R19 N27 G60 R61 M62 R63 Y64 L65 R70 F72 N74 R77 G79 P81 R85

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7z3o, PDBe:7z3o, PDBj:7z3o
PDBsum	7z3o
PubMed	37081320
UniProt	G0S101

[Back to BioLiP]