Structure of PDB 7z3n Chain Lj Binding Site BS02

Receptor Information
>7z3n Chain Lj (length=86) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KGTSSFGKRHNKTHGLCRRCGRRSLHNQKKVCASCGYPAAKTRKYNWSEK
AKRRKVTGTGRMRYLSTVPRRFKNGFRTGVPKGARG
Ligand information
>7z3n Chain 4 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z3n Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R21 N29 K32 G62 R63 M64 Y66 R72 F74 N76 R79 G81 P83
Binding residue
(residue number reindexed from 1)		R19 N27 K30 G60 R61 M62 Y64 R70 F72 N74 R77 G79 P81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7z3n, PDBe:7z3n, PDBj:7z3n
PDBsum7z3n
PubMed37081320
UniProtG0S101

[Back to BioLiP]