Structure of PDB 7old Chain Lj Binding Site BS02

Receptor Information

>7old Chain Lj (length=88) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TKGTSSFGKRHNKTHGLCRRCGRRSLHNQKKVCASCGYPAAKTRKYNWSE
KAKRRKVTGTGRMRYLSTVPRRFKNGFRTGVPKGARGP

Ligand information

>7old Chain 4 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau

.........................................<<<<<<.<<
.....>>>.....(.<<<(.....>>............).>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7old High-resolution structures of a thermophilic eukaryotic 80S ribosome reveal atomistic details of translocation.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	R20 R21 N29 G62 R63 M64 Y66 L67 R72 F74 K75 N76 R79 T80 G81
Binding residue (residue number reindexed from 1)	R19 R20 N28 G61 R62 M63 Y65 L66 R71 F73 K74 N75 R78 T79 G80

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7old, PDBe:7old, PDBj:7old
PDBsum	7old
PubMed	35079002
UniProt	G0S101

[Back to BioLiP]