Structure of PDB 7nrc Chain Lj Binding Site BS02

Receptor Information
>7nrc Chain Lj (length=119) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSI
ACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVT
EKQRKKQIAFPQRKYAIKA
Ligand information
>7nrc Chain LC (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauuu
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nrc Structure of Gcn1 bound to stalled and colliding 80S ribosomes.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		Y7 K35 L41 K45 R48 K49 A52 C53 L55 T56 N59 R63 R67 K78 R81 A82 K83 T85 R86 R89
Binding residue
(residue number reindexed from 1)		Y6 K34 L40 K44 R47 K48 A51 C52 L54 T55 N58 R62 R66 K77 R80 A81 K82 T84 R85 R88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nrc, PDBe:7nrc, PDBj:7nrc
PDBsum7nrc
PubMed33790014
UniProtP0CX84|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)

[Back to BioLiP]