Structure of PDB 8pv6 Chain Lh Binding Site BS02

Receptor Information
>8pv6 Chain Lh (length=122) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NGKVKAGQLWSKNKEELTKILGELKTELSQLRIQKISSSGAKLNKIHDLR
KSIARVLTVINAKQRAQLRLFYKNKKYLPLDLRPKLTRALRRRLSKEDAS
RVLEKTKKRLTHFPQRKYAVKA
Ligand information
>8pv6 Chain C2 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau
.........................................<<<<<<<<<
....>>>>.....<.<<<......>>..............>>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pv6 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
Resolution2.94 Å
Binding residue
(original residue number in PDB)
K8 W13 A44 L46 N47 K54 A57 R58 L60 T61 N64 R68 L83 K88 T90 R91 R94
Binding residue
(residue number reindexed from 1)
K5 W10 A41 L43 N44 K51 A54 R55 L57 T58 N61 R65 L80 K85 T87 R88 R91
Enzymatic activity
Enzyme Commision number 2.4.99.18: dolichyl-diphosphooligosaccharide--protein glycotransferase.
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0004576 oligosaccharyl transferase activity
GO:0004579 dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0016757 glycosyltransferase activity
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0006486 protein glycosylation
GO:0018279 protein N-linked glycosylation via asparagine
GO:0043687 post-translational protein modification
Cellular Component
GO:0005840 ribosome
GO:0016020 membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8pv6, PDBe:8pv6, PDBj:8pv6
PDBsum8pv6
PubMed37921038
UniProtG0S0D7

[Back to BioLiP]