Structure of PDB 8oo0 Chain Lh Binding Site BS02

Receptor Information

>8oo0 Chain Lh (length=122) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NGKVKAGQLWSKNKEELTKILGELKTELSQLRIQKISSSGAKLNKIHDLR
KSIARVLTVINAKQRAQLRLFYKNKKYLPLDLRPKLTRALRRRLSKEDAS
RVLEKTKKRLTHFPQRKYAVKA

Ligand information

>8oo0 Chain 4 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau

.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	K54 R58 L60 T61 R68 T90 R91
Binding residue (residue number reindexed from 1)	K51 R55 L57 T58 R65 T87 R88

Enzymatic activity

Enzyme Commision number

2.4.99.18: dolichyl-diphosphooligosaccharide--protein glycotransferase.

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
PDBsum	8oo0
PubMed	38267453
UniProt	G0S0D7

[Back to BioLiP]