Structure of PDB 6zj3 Chain Lb Binding Site BS02

Receptor Information
>6zj3 Chain Lb (length=203) Species: 3039 (Euglena gracilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVYTYMQFVWNKKQSDVMRFTQRIRAWEYRHSHRMVRLPRPTRTDKARRL
GYKRKPGYVIWRVRVRRGGRKRPVPKGICYGKPKTAGVNHLMNAKNMRVI
AEGRVGKHCGGLRVLNSYWVNADAIYKYFEVILVDPMHKAIRSDPEINWI
CKPRQKHREARGVTSAGRKHRGLRHKGHRATKARPSVRANWKRRNLVKFW
RYR
Ligand information
>6zj3 Chain LB (length=133) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugaccuggcgcacauggaaugacccaccgaacuuaagcauaucacucag
uggaggaacagcaagcaaccucgauugcugcaguaauggcgaaugaacga
gcaggacccacggcucuuccugaaaaugggcuu
.......................<<<<<......<......>.......>
>>>.>.........<......>..<<<<<......<<.....>>.....>
>>>>.............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		G2 Y4 T5 P40 R49 R50 R71 K83 P84 K85 T86 A95 K96 G112 M138 E147 P154 K157 H158 A161 R162 R169 H171 R172 K177 G178 H179 T182 R185 P186 S187 R189 W192 K193 R194 R195 K199 W201
Binding residue
(residue number reindexed from 1)		G1 Y3 T4 P39 R48 R49 R70 K82 P83 K84 T85 A94 K95 G111 M137 E146 P153 K156 H157 A160 R161 R168 H170 R171 K176 G177 H178 T181 R184 P185 S186 R188 W191 K192 R193 R194 K198 W200
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Apr 6 22:32:48 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6zj3', asym_id = 'Lb', bs = 'BS02', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6zj3', asym_id='Lb', bs='BS02', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6zj3', asym_id = 'Lb'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6zj3', asym_id='Lb')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>