Structure of PDB 8rxh Chain La Binding Site BS02

Receptor Information
>8rxh Chain La (length=125) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHHMKIKDLREKSKDDLLKTLTEYKKELSQLRVVQQTGGAETRLGRIRPI
RKSIARILTVLNQNERSNLKMFYADRKLRCKTPKVLRTKLTHRRRLALKE
NEKNRKTSRQMRQAHKFPKRVYAVK
Ligand information
>8rxh Chain L7 (length=166) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagu
aaagugcgauaagugguaucaauugcagaaucauucaauuaccgaaucuu
ugaacgcaaacggcgcaugggagaagcucgugucauccccgugcaugcca
uauucucagugucgaa
.........................................<<<<<<<<<
....>>>>.....(<<<<......>>.............>>>>.)...>>
>....<<.....>><<<<<<<.<..<<....>>..>.>>>>>>>......
................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		S2 H4 K6 I7 R11 Q36 E42 R47 I48 R49 R52 K53 A56 R57 L59 T60 N63 Q64 R67 K71 K85 R88 T89 K90 T92 H93 R96
Binding residue
(residue number reindexed from 1)		S1 H3 K5 I6 R10 Q35 E41 R46 I47 R48 R51 K52 A55 R56 L58 T59 N62 Q63 R66 K70 K84 R87 T88 K89 T91 H92 R95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum8rxh
PubMed38722744
UniProtQ4Q8V7

[Back to BioLiP]