Structure of PDB 8pv6 Chain LY Binding Site BS02

Receptor Information
>8pv6 Chain LY (length=133) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVRPTVSSSRRKARKAHFSAPSSVRRVIMSAPLSKELREKYNVRSIPIR
KGDEVQIVRGAHKDKEGKVTSVYRLKYVIHVERVTREKATGQTVPIGIHP
SNVVITKLHLDKDRENILARIKAGREQVAKAKG
Ligand information
>8pv6 Chain C2 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau
.........................................<<<<<<<<<
....>>>>.....<.<<<......>>..............>>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pv6 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
Resolution2.94 Å
Binding residue
(original residue number in PDB)
R11 R12 R15 K16 F19 P22 S23 S24 R27 R50 K51 V72 Y73 R74 H109 D111 K112 D113 I117 R120
Binding residue
(residue number reindexed from 1)
R11 R12 R15 K16 F19 P22 S23 S24 R27 R50 K51 V72 Y73 R74 H109 D111 K112 D113 I117 R120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8pv6, PDBe:8pv6, PDBj:8pv6
PDBsum8pv6
PubMed37921038
UniProtG0RYN9

[Back to BioLiP]