Structure of PDB 8oo0 Chain LY Binding Site BS02

Receptor Information

>8oo0 Chain LY (length=134) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKVRPTVSSSRRKARKAHFSAPSSVRRVIMSAPLSKELREKYNVRSIPIR
KGDEVQIVRGAHKDKEGKVTSVYRLKYVIHVERVTREKATGQTVPIGIHP
SNVVITKLHLDKDRENILARIKAGREQVAKAKGK

Ligand information

>8oo0 Chain 4 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau

.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	R12 R15 F19 S24 R27 R50 Y73 R74 L75 K112 D113
Binding residue (residue number reindexed from 1)	R12 R15 F19 S24 R27 R50 Y73 R74 L75 K112 D113

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
PDBsum	8oo0
PubMed	38267453
UniProt	G0RYN9

[Back to BioLiP]