Structure of PDB 8k2d Chain LY Binding Site BS02

Receptor Information

>8k2d Chain LY (length=124) Species: 4932 (Saccharomyces cerevisiae)

AKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIR
RDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHP
SKLVITKLHLDKDRKALIQRKGGK

Ligand information

>8k2d Chain C3 (length=157)

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauu

.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8k2d Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): R12 R13 R16 K17 F20 P23 S24 R51 R52 V73 Y74 R75 L111 D112 K113 D114
• Binding residue (residue number reindexed from 1): R11 R12 R15 K16 F19 P22 S23 R50 R51 V72 Y73 R74 L110 D111 K112 D113

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k2d, PDBe:8k2d, PDBj:8k2d
• PDBsum: 8k2d
• PubMed: 38942792
• UniProt: P05743|RL26A_YEAST Large ribosomal subunit protein uL24A (Gene Name=RPL26A)