Structure of PDB 4v3p Chain LY Binding Site BS02

Receptor Information
>4v3p Chain LY (length=130) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKRNPRVTSSRRKCRKAHFTAPSSVRRVLMSAALSTELRHKYNVRSIPIR
KDDEVQVVRGSYKGREGKVVQVYRRRWVIHVERITREKVNGSTVNVGIHP
SKVVVTKLKLDKDRKAILDRKASGRAADKA
Ligand information
>4v3p Chain L2 (length=159) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gacucucggcaacggauaucucggcucucgcaucgaugaagaacguagcg
aaaugcgauaccuggugugaauugcagaaucccgugaaccaucgagucuu
ugaacgcaaguugcgcccgaggccacucgggcgagggcacgccugccugg
gcgucacgc
........................................<<<<<<....
....>>>....<<.......<<<....>>>..............>>..>>
>....<<<...>>><<<<..<.<<....>>.>..>>>>............
.........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v3p The molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes.
Resolution34.0 Å
Binding residue
(original residue number in PDB)		R11 R12 R15 K16 F19 S23 S24 R26 R27 M30 I49 R50 K51 D52 V72 Y73 R74 R75 K109 D111 K112 D113 R114 R120
Binding residue
(residue number reindexed from 1)		R11 R12 R15 K16 F19 S23 S24 R26 R27 M30 I49 R50 K51 D52 V72 Y73 R74 R75 K109 D111 K112 D113 R114 R120
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 11:27:23 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4v3p', asym_id = 'LY', bs = 'BS02', title = 'The molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4v3p', asym_id='LY', bs='BS02', title='The molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015934', uniprot = '', pdbid = '4v3p', asym_id = 'LY'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015934', uniprot='', pdbid='4v3p', asym_id='LY')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>