Structure of PDB 8pvk Chain LX Binding Site BS02

Receptor Information

>8pvk Chain LX (length=145) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SKAAKGAQAKKAAQAALKGVHSHKKTKVRKSTTFHRPKTLVLSRAPKYPR
KSIPHEPRLDEHKIIIHPLNTEGALKKIEEQNTLVFIVDVKANKAQIKQA
LKKLYDIDTVKINTLIRPDGTKKAFARLTPDVDALDIAATKLGLV

Ligand information

>8pvk Chain C2 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau

.........................................<<<<<<<<<
....>>>>.....<.<<<......>>..............>>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8pvk Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
Resolution	2.55 Å
Binding residue (original residue number in PDB)	H32 K35 K38 P48 T50 R55 K62 H66 P68 R69 K74 A106 Q107
Binding residue (residue number reindexed from 1)	H21 K24 K27 P37 T39 R44 K51 H55 P57 R58 K63 A95 Q96

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pvk, PDBe:8pvk, PDBj:8pvk
PDBsum	8pvk
PubMed	37921038
UniProt	G0S507

[Back to BioLiP]