Structure of PDB 8onz Chain LX Binding Site BS02

Receptor Information
>8onz Chain LX (length=121) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTKVRKSTTFHRPKTLVLSRAPKYPRKSIPHEPRLDEHKIIIHPLNTEGA
LKKIEEQNTLVFIVDVKANKAQIKQALKKLYDIDTVKINTLIRPDGTKKA
FARLTPDVDALDIAATKLGLV
Ligand information
>8onz Chain 2 (length=59) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacgcagcgaaaugcgauaaguaaugugaauugcagaauuccgugaauca
ucgaaucuu
<<<<<<<<....>>>>.....<.<<<......>>..............>>
>..>...>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8onz Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
Resolution2.94 Å
Binding residue
(original residue number in PDB)		H66 K74
Binding residue
(residue number reindexed from 1)		H31 K39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8onz, PDBe:8onz, PDBj:8onz
PDBsum8onz
PubMed38267453
UniProtG0S507

[Back to BioLiP]