Structure of PDB 8k82 Chain LX Binding Site BS02

Receptor Information
>8k82 Chain LX (length=120) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSETA
MKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKA
YVRLTADYDALDIANRIGYI
Ligand information
>8k82 Chain C3 (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauuu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		P35 T37 L38 R42 K49 H53 Y54 N55 R56 K61 M88 K89 Y93 Q94
Binding residue
(residue number reindexed from 1)		P13 T15 L16 R20 K27 H31 Y32 N33 R34 K39 M66 K67 Y71 Q72
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k82, PDBe:8k82, PDBj:8k82
PDBsum8k82
PubMed38942792
UniProtP04456|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)

[Back to BioLiP]