Structure of PDB 8rxx Chain LW Binding Site BS02

Receptor Information
>8rxx Chain LW (length=121) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASIKCGSRRKARRAHFQAPSHVRRVLMSAPLSKELRAKYNVRAMPVRKDD
EVIVKRGTFKGREGKVTACYRLKWVILIDKVNREKANGSTVAVGIHPSNV
EITKLKLTHHRKSILERKDRS
Ligand information
>8rxx Chain L7 (length=166) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagu
aaagugcgauaagugguaucaauugcagaaucauucaauuaccgaaucuu
ugaacgcaaacggcgcaugggagaagcucgugucauccccgugcaugcca
uauucucagugucgaa
.........................................<<<<<<<<<
....>>>>.....(<<<<......>>.............>>>>.)...>>
>....<<.....>><<<<<<<.<..<<....>>..>.>>>>>>>......
................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.97 Å
Binding residue
(original residue number in PDB)		R10 R13 R14 F17 Q18 P20 S21 H22 R25 R48 K49 C70 Y71 R72 L73 T109 H110 H111 R112 R118
Binding residue
(residue number reindexed from 1)		R9 R12 R13 F16 Q17 P19 S20 H21 R24 R47 K48 C69 Y70 R71 L72 T108 H109 H110 R111 R117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0031981 nuclear lumen
GO:0097014 ciliary plasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum8rxx
PubMed38722744
UniProtQ4QAC5

[Back to BioLiP]