Structure of PDB 7zw0 Chain LV Binding Site BS02

Receptor Information

>7zw0 Chain LV (length=171) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKV
KKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVA
AVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFP
LPHRVQKSTKTFSYKRPSTFY

Ligand information

>7zw0 Chain LC (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu

<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7zw0 Sensing of individual stalled 80S ribosomes by Fap1 for nonfunctional rRNA turnover.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	R13 S39 Y43 Q46 H49 K50 V51 K52 K53 R84 R119
Binding residue (residue number reindexed from 1)	R12 S38 Y42 Q45 H48 K49 V50 K51 K52 R83 R118

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zw0, PDBe:7zw0, PDBj:7zw0
PDBsum	7zw0
PubMed	36113412
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]