Structure of PDB 8rxx Chain LU Binding Site BS02

Receptor Information

>8rxx Chain LU (length=122) Species: 347515 (Leishmania major strain Friedlin)

VAVRAKVGSRSYVRQKQLAKGKKVFKIDCSIPAADGIFSEDVLGNFEQFF
QDNTKLNGRKGKLSDKVRLSMNDNVLTISTTMAYRKKYFKYLTKKFLKKK
DLRDWIRILATGKGTYQLKYFN

Ligand information

>8rxx Chain L3 (length=183)

agugguaaugcgaaacacuugccagguaacaaaucaauccucccacggug
agcuuucuuuucaccauaauccaccuugggccuuuuuacuuucgcguugu
ucggagcgggggcucaagauugaaaaaugcagcucuuacugucauuugug
aguucugcgcauuaaagcaaaaaccuggggugu

.<<......>>.....<<<..<<<<<<.......<<...<<<....<<<<
<<.......>>>>>><...<<.<.<<<<<<<<<<<.......<<......
.>>....>>>>>>>>>>>.>.>>....><..<..........>..>...>
>>...>>...............>>>>>>>>>..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
• Resolution: 2.97 Å
• Binding residue (original residue number in PDB): Q16 K56 N58 G59 K61 Y85 R86 K87 K88 Y89 K91 Y92 K96 K99 K100 R104 R108 L110 A111 K114 K120
• Binding residue (residue number reindexed from 1): Q15 K55 N57 G58 K60 Y84 R85 K86 K87 Y88 K90 Y91 K95 K98 K99 R103 R107 L109 A110 K113 K119

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
• PDBsum: 8rxx
• PubMed: 38722744
• UniProt: Q4Q0X2