Structure of PDB 8pv6 Chain LP Binding Site BS02

Receptor Information

>8pv6 Chain LP (length=171) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VRYAATEIAPTKSARARGSYLRVSFKNTRETAQAINGWKLQRALTFLQNV
IDKKEAVPMRRYAGSTGRTAQGKQWGVSRARWPVKSAQFLIGLLKNAEAN
ADAKGLDTGNLIIKHIQVNQAPKQRRRTYRAHGRINPYMSNPCHIELILT
EAEESHLSSRQRGVRIRRALT

Ligand information

>8pv6 Chain C2 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau

.........................................<<<<<<<<<
....>>>>.....<.<<<......>>..............>>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8pv6 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
Resolution	2.94 Å
Binding residue (original residue number in PDB)	R3 A5 R61 R62 Q118 N120 Q121 P123 H145
Binding residue (residue number reindexed from 1)	R2 A4 R60 R61 Q117 N119 Q120 P122 H144

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pv6, PDBe:8pv6, PDBj:8pv6
PDBsum	8pv6
PubMed	37921038
UniProt	G0SGY1

[Back to BioLiP]