Structure of PDB 8oo0 Chain LP Binding Site BS02

Receptor Information

>8oo0 Chain LP (length=186) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VRYAATEIAPTKSARARGSYLRVSFKNTRETAQAINGWKLQRALTFLQNV
IDKKEAVPMRRYAGSTGRTAQGKQWGVSRARWPVKSAQFLIGLLKNAEAN
ADAKGLDTGNLIIKHIQVNQAPKQRRRTYRAHGRINPYMSNPCHIELILT
EAEETVQKSEAVVRDVESHLSSRQRGVRIRRALTAA

Ligand information

>8oo0 Chain 4 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau

.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	R3 R62
Binding residue (residue number reindexed from 1)	R2 R61

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
PDBsum	8oo0
PubMed	38267453
UniProt	G0SGY1

[Back to BioLiP]