Structure of PDB 7z3n Chain LP Binding Site BS02

Receptor Information

>7z3n Chain LP (length=186) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VRYAATEIAPTKSARARGSYLRVSFKNTRETAQAINGWKLQRALTFLQNV
IDKKEAVPMRRYAGSTGRTAQGKQWGVSRARWPVKSAQFLIGLLKNAEAN
ADAKGLDTGNLIIKHIQVNQAPKQRRRTYRAHGRINPYMSNPCHIELILT
EAEETVQKSEAVVRDVESHLSSRQRGVRIRRALTAA

Ligand information

>7z3n Chain 4 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau

.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7z3n Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	A5 R61 N120 P123
Binding residue (residue number reindexed from 1)	A4 R60 N119 P122

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7z3n, PDBe:7z3n, PDBj:7z3n
PDBsum	7z3n
PubMed	37081320
UniProt	G0SGY1

[Back to BioLiP]