Structure of PDB 7cpv Chain LP Binding Site BS02

Receptor Information
>7cpv Chain LP (length=154) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDV
TLKKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESN
AELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILT
EKEQ
Ligand information
>7cpv Chain L8 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcu
.........................................<<<<<<<<<
....>>>>.....<.<<<......>>.............>>>..>...>>
>....<<....>><<<<<<<<<.....>>>>>>>>>..............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cpv A male germ-cell-specific ribosome controls male fertility.
Resolution3.03 Å
Binding residue
(original residue number in PDB)
R3 S5 R61 R62 W78 N120 K121 P123 H145
Binding residue
(residue number reindexed from 1)
R2 S4 R60 R61 W77 N119 K120 P122 H144
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0140236 translation at presynapse
GO:0140242 translation at postsynapse
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0045202 synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7cpv, PDBe:7cpv, PDBj:7cpv
PDBsum7cpv
PubMed36517592
UniProtQ9CPR4|RL17_MOUSE Large ribosomal subunit protein uL22 (Gene Name=Rpl17)

[Back to BioLiP]