Structure of PDB 8i9t Chain LN Binding Site BS02

Receptor Information

>8i9t Chain LN (length=183) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GALKYLEELSKKKQSDVVRFLLRVRCWEYRQLNVIHRASRPSRPDKARRL
GYKAKQGYVIYRVRVRRGGRQLKYQRSLRATAEERVGRRCSNLRVLNSYW
VNQDSTYKYYEVILVDPNHKAIRRDPRINWICNPVHKHRECRGLTSTGKK
SRGLNKGHRFNKTRAGRRKTWKRHNTLSLWRYR

Ligand information

>8i9t Chain C2 (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucauuu

.........................................<<<<<<.<<
.....>>>.....(.<<<(.....>>............).>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8i9t Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	R38 Y62 C110 N112
Binding residue (residue number reindexed from 1)	R37 Y61 C90 N92

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i9t, PDBe:8i9t, PDBj:8i9t
PDBsum	8i9t
PubMed	37129998
UniProt	G0RZ88

[Back to BioLiP]