Structure of PDB 8pv6 Chain LJ Binding Site BS02

Receptor Information

>8pv6 Chain LJ (length=168) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AQNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTV
RQFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRRRNFSETGNFGF
GISEHIDLGIKYDPSIGIYGMDFYCCMTRPGERVAKRRRCKSRIGASHRI
TREETIRWFKQRFDGIVR

Ligand information

>8pv6 Chain C4 (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acguacgaccauacccaguggaaagcacggcaucccguccgcucugcccu
aguuaagccacugagggcccgguuaguaguugggucgggaccagcgaauc
ccggguguuguacgu

<<<<<<<<<....<<<<<<<<.....<<<<<<............>>>>..
.>>....>>>>>>.>><<<<<<......<<<<<.......>>>>>.....
>>>>>>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8pv6 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
Resolution	2.94 Å
Binding residue (original residue number in PDB)	N8 M10 R11 Q44 T45 V47 T71 R73 R138 V139 K141 R142 S147 R148 G150 S152 H153
Binding residue (residue number reindexed from 1)	N3 M5 R6 Q39 T40 V42 T66 R68 R133 V134 K136 R137 S142 R143 G145 S147 H148

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pv6, PDBe:8pv6, PDBj:8pv6
PDBsum	8pv6
PubMed	37921038
UniProt	G0SHQ2

[Back to BioLiP]