Structure of PDB 8pv4 Chain LJ Binding Site BS02

Receptor Information

>8pv4 Chain LJ (length=169) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KAQNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYT
VRQFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRRRNFSETGNFG
FGISEHIDLGIKYDPSIGIYGMDFYCCMTRPGERVAKRRRCKSRIGASHR
ITREETIRWFKQRFDGIVR

Ligand information

>8pv4 Chain C4 (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acguacgaccauacccaguggaaagcacggcaucccguccgcucugcccu
aguuaagccacugagggcccgguuaguaguugggucggugacgaccagcg
aaucccggguguuguacgu

<<<<<<<<<....<<<<<<<<.....<<<<<<............>>>>..
.>>....>>>>>>.>><<<<<<......<<<<.<<<<....>>>>>>>>.
....>>>>>>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8pv4 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	K5 N8 M10 R11 Q44 T45 V47 T71 R73 G136 R138 V139 R142 R144 S147 G150 A151 S152 H153 R154
Binding residue (residue number reindexed from 1)	K1 N4 M6 R7 Q40 T41 V43 T67 R69 G132 R134 V135 R138 R140 S143 G146 A147 S148 H149 R150

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pv4, PDBe:8pv4, PDBj:8pv4
PDBsum	8pv4
PubMed	37921038
UniProt	G0SHQ2

[Back to BioLiP]