Structure of PDB 8p8n Chain LI Binding Site BS02

Receptor Information
>8p8n Chain LI (length=286) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTN
KDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIAR
RTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGA
RVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQY
MEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFKPTE
KKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAAL
Ligand information
>8p8n Chain LE (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p8n Real-space refinement in PHENIX for cryo-EM and crystallography.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		S10 S13 S14 F16 T18 F20 R21 R22 T28 Y30 R33 R50 R54 T56 N57 K58 Q63 I65 I69 D72 V74 Y79 G91 N94 W95 Q151 R152 T154 T155 A157 R158 Y198 H203 Y207 R218 E221 K224 F253 T256 K258 F260 Q264 Y265 A266 E268 S269 K270 Y272 R273 Q274 K276 L277 R285 V286
Binding residue
(residue number reindexed from 1)		S3 S6 S7 F9 T11 F13 R14 R15 T21 Y23 R26 R43 R47 T49 N50 K51 Q56 I58 I62 D65 V67 Y72 G84 N87 W88 Q144 R145 T147 T148 A150 R151 Y191 H196 Y200 R211 E214 K217 F246 T249 K251 F253 Q257 Y258 A259 E261 S262 K263 Y265 R266 Q267 K269 L270 R278 V279
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p8n, PDBe:8p8n, PDBj:8p8n
PDBsum8p8n
PubMed
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]