Structure of PDB 8p8m Chain LI Binding Site BS02

Receptor Information
>8p8m Chain LI (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>8p8m Chain LE (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p8m Yeast 60S ribosomal subunit, RPL39 deletion
Resolution2.66 Å
Binding residue
(original residue number in PDB)		A2 S13 S14 F16 T18 F20 R21 R22 R24 T28 Y30 R33 R54 N57 D59 I65 I69 D72 V74 Y79 G91 N94 W95 Q151 R152 T155 A157 R158 Y198 H203 V204 Y207 E210 R218 E221 T256 K258 K259 F260 K262 Y265 A266 E268 S269 K270 Y272 R273 Q274 T275 K276 L277 K279 R285 V286
Binding residue
(residue number reindexed from 1)		A1 S12 S13 F15 T17 F19 R20 R21 R23 T27 Y29 R32 R53 N56 D58 I64 I68 D71 V73 Y78 G90 N93 W94 Q150 R151 T154 A156 R157 Y197 H202 V203 Y206 E209 R217 E220 T255 K257 K258 F259 K261 Y264 A265 E267 S268 K269 Y271 R272 Q273 T274 K275 L276 K278 R284 V285
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p8m, PDBe:8p8m, PDBj:8p8m
PDBsum8p8m
PubMed
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]