Structure of PDB 8g60 Chain LI Binding Site BS02

Receptor Information
>8g60 Chain LI (length=208) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGH
MVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINK
MLSCAQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAK
FKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRGPL
DKWRALHS
Ligand information
>8g60 Chain L7 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcuu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g60 mRNA decoding in human is kinetically and structurally distinct from bacteria.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		Y11 E56 Y57 I131 Y199 S202 R203 G204 P205 L206 W209
Binding residue
(residue number reindexed from 1)		Y10 E55 Y56 I125 Y193 S196 R197 G198 P199 L200 W203
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0045182 translation regulator activity
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0043066 negative regulation of apoptotic process
GO:1990403 embryonic brain development
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005790 smooth endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0032991 protein-containing complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g60, PDBe:8g60, PDBj:8g60
PDBsum8g60
PubMed37020024
UniProtP27635|RL10_HUMAN Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]