Structure of PDB 6z6k Chain LI Binding Site BS02

Receptor Information
>6z6k Chain LI (length=209) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
QGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQ
QKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNIRE
FPEYFAAQA
Ligand information
>6z6k Chain C4 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6z6k Structure and function of yeast Lso2 and human CCDC124 bound to hibernating ribosomes.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R10 Y11 E56 I131 K203 G204 S205 L206 F217
Binding residue
(residue number reindexed from 1)		R9 Y10 E55 I119 K191 G192 S193 L194 F205
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006415 translational termination
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6z6k, PDBe:6z6k, PDBj:6z6k
PDBsum6z6k
PubMed32687489
UniProtP41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]