Structure of PDB 8pvk Chain LG Binding Site BS02

Receptor Information

>8pvk Chain LG (length=235) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PKNPLLEKRPRNFGIGQDIQPKRNLSRMVKWPEYIRLQRQKKILRMRLKV
PPAIAQFQYTLDKNLAAQAFKLLNKYRPETKQEKKERLLREATAIKEGKK
KEDVSKKPYTVKYGLNHVVGLIENKKASLVLIANDVDPIELVVFLPALCR
KMGIPYAIIKGKARLGTLVHKKTAAVVAITEVRSEDKNELAKLISAVKEG
YLEKVEDTRKRWGGGIMGFKAQKREEKRKKSLETA

Ligand information

>8pvk Chain C2 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauaaguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgcccgccgguauuccggcgggcaugccuguucgag
cgucau

.........................................<<<<<<<<<
....>>>>.....<.<<<......>>..............>>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8pvk Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
Resolution	2.55 Å
Binding residue (original residue number in PDB)	Y58 I59 Q62 R63 K66 K87 D159 K184
Binding residue (residue number reindexed from 1)	Y34 I35 Q38 R39 K42 K63 D135 K160

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pvk, PDBe:8pvk, PDBj:8pvk
PDBsum	8pvk
PubMed	37921038
UniProt	G0SAJ9

[Back to BioLiP]