Structure of PDB 7zjw Chain LG Binding Site BS02

Receptor Information
>7zjw Chain LG (length=294) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
cFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM
IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCT
GLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLA
RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG
QNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENP
VYEKKPKREVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAA
Ligand information
>7zjw Chain L7 (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaag
cuaagcagggucgggccugguuaguacuuggaugggagaccgccugggaa
uaccgggugcuguaggcuu
<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..>
>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>...
.>>>>>>>>>>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zjw Structure of the mammalian ribosome as it decodes the selenocysteine UGA codon.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K8 K10 F13 K14 Y16 V18 F20 R21 R22 R24 T28 Y30 R33 R50 I52 R54 T56 N57 R58 I61 Q63 I69 E70 G71 D72 M73 I74 Y79 N94 R152 T155 N157 K158 Y207 Q222 S224 Q225 Y226 Y253 K255 R259 V261 W266 N267 R268 K270 M271 L273 K277 R279 V280
Binding residue
(residue number reindexed from 1)		K7 K9 F12 K13 Y15 V17 F19 R20 R21 R23 T27 Y29 R32 R49 I51 R53 T55 N56 R57 I60 Q62 I68 E69 G70 D71 M72 I73 Y78 N93 R151 T154 N156 K157 Y206 Q221 S223 Q224 Y225 Y252 K254 R258 V260 W265 N266 R267 K269 M270 L272 K276 R278 V279
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zjw, PDBe:7zjw, PDBj:7zjw
PDBsum7zjw
PubMed35709277
UniProtP19949|RL5_RABIT Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]