Structure of PDB 7nrc Chain LG Binding Site BS02

Receptor Information
>7nrc Chain LG (length=294) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVV
RFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGL
LIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRT
TTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGH
VSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAF
KPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>7nrc Chain LB (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nrc Structure of Gcn1 bound to stalled and colliding 80S ribosomes.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		S13 S14 F16 T18 F20 R21 R22 R24 R33 R50 V52 R54 T56 N57 K58 D59 I69 T70 D72 V74 H90 G91 N94 Q151 R152 G156 A157 R158 Y198 H203 Q206 Y207 E210 E221 L222 F223 K224 F253 T256 K258 K259 F260 K262 Q264 Y265 A266 E268 S269 K270 Y272 Q274 K276 L277 R282 K289
Binding residue
(residue number reindexed from 1)		S10 S11 F13 T15 F17 R18 R19 R21 R30 R47 V49 R51 T53 N54 K55 D56 I66 T67 D69 V71 H87 G88 N91 Q148 R149 G153 A154 R155 Y195 H200 Q203 Y204 E207 E218 L219 F220 K221 F250 T253 K255 K256 F257 K259 Q261 Y262 A263 E265 S266 K267 Y269 Q271 K273 L274 R279 K286
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nrc, PDBe:7nrc, PDBj:7nrc
PDBsum7nrc
PubMed33790014
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]