Structure of PDB 8fle Chain LE Binding Site BS02

Receptor Information
>8fle Chain LE (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKG
MPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRINVRIEHIKHSKS
RDSFLKRVKENDQKKKEAKEWVQLKRQPAPPREAHFVRTNGKEPELLEPI
PYEF
Ligand information
>8fle Chain L4 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcuu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fle Principles of human pre-60S biogenesis
Resolution2.48 Å
Binding residue
(original residue number in PDB)
R20 P26 A28
Binding residue
(residue number reindexed from 1)
R19 P25 A27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fle, PDBe:8fle, PDBj:8fle
PDBsum8fle
PubMed37410842
UniProtP46778|RL21_HUMAN Large ribosomal subunit protein eL21 (Gene Name=RPL21)

[Back to BioLiP]